{"product_id":"proteintech-27077-1-ap","title":"Proteintech, 27077-1-AP, NIPA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NIPA1 (27077-1-AP) by Proteintech is a Polyclonal antibody targeting NIPA1 in WB, ELISA applications with reactivity to human, Mouse, Rat samples\n27077-1-AP targets NIPA1 in WB, ELISA applications and shows reactivity with human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNonimprinted in Prader-Willi\/Angelman loci 1 (NIPA1, also known as SPG6) gene is located in the pericentromeric region of chromosome 15q and encodes a magnesium transporter located in the plasma membrane and early endosomes, implicated in neuronal development and maintenance (PMID: 17166836). NIPA1 is highly conserved along phylogeny and highly expressed in neuronal tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23847 Product name: Recombinant human NIPA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 194-277 aa of BC025678 Sequence: RYINKALECFDSSVFGAIYYVVFTTLVLLASAILFREWSNVGLVDFLGMACGFTTVSVGIVLIQVFKEFNFNLGEMNKSNMKTD Predict reactive species\nFull Name: non imprinted in Prader-Willi\/Angelman syndrome 1\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC025678\nGene Symbol: NIPA1\nGene ID (NCBI): 123606\nRRID: AB_3085923\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7RTP0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887737229481,"sku":"27077-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27077-1-ap","provider":"Iright","version":"1.0","type":"link"}