{"product_id":"proteintech-27079-1-ap","title":"Proteintech, 27079-1-AP, Growth Hormone Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Growth Hormone (27079-1-AP) by Proteintech is a Polyclonal antibody targeting Growth Hormone in WB, IHC, ELISA applications with reactivity to human samples\n27079-1-AP targets Growth Hormone in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human pituitary adenoma tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGH1, also named as GH or GH-N, belongs to the somatotropin\/prolactin family.  GH1 plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22841 Product name: Recombinant human GH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-98 aa of BC075012 Sequence: LPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSN Predict reactive species\nFull Name: GH1\nCalculated Molecular Weight: 217 aa, 25 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC075012\nGene Symbol: GH1\nGene ID (NCBI): 2688\nRRID: AB_2880745\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01241\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887660126377,"sku":"27079-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27079-1-ap","provider":"Iright","version":"1.0","type":"link"}