{"product_id":"proteintech-27081-1-ap","title":"Proteintech, 27081-1-AP, TTPA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTPA (27081-1-AP) by Proteintech is a Polyclonal antibody targeting TTPA in WB, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n27081-1-AP targets TTPA in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24177 Product name: Recombinant human TTPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 218-278 aa of BC058000 Sequence: IKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ Predict reactive species\nFull Name: tocopherol (alpha) transfer protein\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 29-32 kDa\nGenBank Accession Number: BC058000\nGene Symbol: TTPA\nGene ID (NCBI): 7274\nRRID: AB_2880747\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49638\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869782757545,"sku":"27081-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27081-1-ap","provider":"Iright","version":"1.0","type":"link"}