{"product_id":"proteintech-27083-1-ap","title":"Proteintech, 27083-1-AP, SCRIB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SCRIB (27083-1-AP) by Proteintech is a Polyclonal antibody targeting SCRIB in WB, IHC, ELISA applications with reactivity to human, mouse samples\n27083-1-AP targets SCRIB in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCRIB encodes a large, 260-kDa cytoplasmic scaffolding protein that comprises a large leucine-rich repeat (LRR) region and 4 PDZ domains that regulate protein-protein interactions. In mammals, cell polarity is established and maintained by at least 3 protein modules (Scrib, Crumbs, and Par). The apical (Crumbs and Par) and basolateral (Scrib) modules function in a mutually antagonistic relationship to regulate various polarization processes such as apical-basal polarity, planar cell polarity, asymmetric cell division and migration. The loss of SCRIB in malignant tumors suggest that it has potential to be a tumor suppressor. Alteration of polarity through deletion, downregulation, overexpression, and mislocalization can induce structural and functional alteration of cells that might be related to tumorigenesis. Mislocalization of SCRIB is involved in epithelial-to-mesenchymal transition (EMT) by inducing loss of E-cadherin. Deregulated SCRIB expression induces tumorigenesis in breast and liver. (PMID: 28460446, PMID: 32564009)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25795 Product name: Recombinant human SCRIB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1331-1630 aa of BC036905 Sequence: HPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSPTSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRALWRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTSTSPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRPGRRGLGPVPS Predict reactive species\nFull Name: scribbled homolog (Drosophila)\nCalculated Molecular Weight: 1630 aa, 175 kDa\nObserved Molecular Weight: 260 kDa\nGenBank Accession Number: BC036905\nGene Symbol: SCRIB\nGene ID (NCBI): 23513\nRRID: AB_2880749\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14160\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869496889513,"sku":"27083-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27083-1-ap","provider":"Iright","version":"1.0","type":"link"}