{"product_id":"proteintech-27096-1-ap","title":"Proteintech, 27096-1-AP, Integrin Alpha V Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin Alpha V (27096-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin Alpha V in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n27096-1-AP targets Integrin Alpha V in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, A549 cells,  MCF-7 cells,  human placenta tissue\nPositive IHC detected in: human Hepatocellular carcinoma, human breast cancer tissue,  human liver cancer tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\nPositive FC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha V, also known as CD51, is a type I transmembrane glycoprotein composed of an extracellular domain, a transmembrane region and cytoplasmic domain (PMID: 2430295; 1690718). It can form heterodimers with one of the five beta integrin subunits (beta 1, 3, 5, 6, 8) that recognize ligands containing the sequence Arg-Gly-Asp, such as vitronectin, fibronectin, and osteopontin (PMID: 37087799). Integrin alpha V mainly plays a role in extracellular matrix-mediated cell adhesion and migration, differentiation, wound healing, inflammation, tumorigenesis, proliferation, angiogenesis, and metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25825 Product name: Recombinant human ITGAV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 819-915 aa of BC136442 Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ Predict reactive species\nFull Name: integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)\nCalculated Molecular Weight: 1048 aa, 116 kDa\nObserved Molecular Weight: 120-130 kDa, 27 kDa\nGenBank Accession Number: BC136442\nGene Symbol: Integrin alpha V\nGene ID (NCBI): 3685\nRRID: AB_2880753\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06756\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869480617,"sku":"27096-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27096-1-ap","provider":"Iright","version":"1.0","type":"link"}