{"product_id":"proteintech-27124-1-ap","title":"Proteintech, 27124-1-AP, ADAM15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM15 (27124-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM15 in WB, ELISA applications with reactivity to human samples\n27124-1-AP targets ADAM15 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAM15, a member of the ADAM (a disintegrin and metalloprotease) family, is a membrane protein containing both protease and adhesion domains and may be involved in tumor invasion and metastasis (PMID:15756594). It is also named as MDC15. ADAM15 is required for the activation of the FAK and Src pathways to generate apoptosis resistance in response to apoptotic signalling or cell stress (PMID: 11741929). ADAM15 is processed during epididymal maturation and acrosome reaction and that it may play a role during sperm-egg binding. Jurkat and testicular cells expresses the precursor ADAM15 of 110 kDa, as well as the ADAM15 processing form, consisting of about 75-85 kDa (PMID:18390692). ADAM15 has some isoforms with the calculated molecular mass of 55~92 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25947 Product name: Recombinant human ADAM15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 362-486 aa of BC014566 Sequence: GNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGD Predict reactive species\nFull Name: ADAM metallopeptidase domain 15\nCalculated Molecular Weight: 93 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC014566\nGene Symbol: ADAM15\nGene ID (NCBI): 8751\nRRID: AB_2923577\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13444\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869801959593,"sku":"27124-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27124-1-ap","provider":"Iright","version":"1.0","type":"link"}