{"product_id":"proteintech-27153-1-ap","title":"Proteintech, 27153-1-AP, PR3\/PRTN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PR3\/PRTN3 (27153-1-AP) by Proteintech is a Polyclonal antibody targeting PR3\/PRTN3 in WB, IHC, ELISA applications with reactivity to human samples\n27153-1-AP targets PR3\/PRTN3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human spleen tissue, human placenta tissue\nPositive IHC detected in: human spleen tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25915 Product name: Recombinant human PRTN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 89-150 aa of BC096183 Sequence: NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT Predict reactive species\nFull Name: proteinase 3\nCalculated Molecular Weight: 256 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC096183\nGene Symbol: PRTN3\nGene ID (NCBI): 5657\nRRID: AB_2880777\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P24158\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887775404201,"sku":"27153-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27153-1-ap","provider":"Iright","version":"1.0","type":"link"}