{"product_id":"proteintech-27157-1-ap","title":"Proteintech, 27157-1-AP, ZFPL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZFPL1 (27157-1-AP) by Proteintech is a Polyclonal antibody targeting ZFPL1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n27157-1-AP targets ZFPL1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ZFPL1 protein is a zinc finger protein localized to the Golgi apparatus, and its function is closely associated with maintaining Golgi structural integrity. Research indicates that ZFPL1 interacts with the Golgi matrix protein GM130 through its N-terminal domain, and this interaction is crucial for the proper anchoring of GM130 to the Golgi. When ZFPL1 expression is suppressed, GM130 dissociates from the membrane, leading to the fragmentation of the Golgi ribbon structure and significantly impairing protein secretion and transport processes. Therefore, ZFPL1 is considered a key scaffolding protein essential for maintaining the normal structure and function of the Golgi apparatus. Currently, its specific role in highly polarized cells with active secretory functions, such as neurons, is a major focus in the field.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24097 Product name: Recombinant human ZFPL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-264 aa of BC012814 Sequence: MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRPLTLLQR Predict reactive species\nFull Name: zinc finger protein-like 1\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC012814\nGene Symbol: ZFPL1\nGene ID (NCBI): 7542\nRRID: AB_2880781\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95159\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887929839785,"sku":"27157-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27157-1-ap","provider":"Iright","version":"1.0","type":"link"}