{"product_id":"proteintech-27166-1-ap","title":"Proteintech, 27166-1-AP, GJB5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GJB5 (27166-1-AP) by Proteintech is a Polyclonal antibody targeting GJB5 in IP, ELISA applications with reactivity to human, mouse samples\n27166-1-AP targets GJB5 in IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGJB5, also known as Connexin31.1, is a connexin subtype associated with apoptosis in organs such as the eye and ovary; it is not highly expressed in many tissues in normal conditions (PMID:32592185).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26052 Product name: Recombinant human GJB5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-273 aa of BC004379 Sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLLPDRPRDHVKKTIL Predict reactive species\nFull Name: gap junction protein, beta 5, 31.1kDa\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC004379\nGene Symbol: GJB5\nGene ID (NCBI): 2709\nRRID: AB_3085930\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95377\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887651410089,"sku":"27166-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27166-1-ap","provider":"Iright","version":"1.0","type":"link"}