{"product_id":"proteintech-27183-1-ap","title":"Proteintech, 27183-1-AP, SLC7A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC7A3 (27183-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n27183-1-AP targets SLC7A3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC7A3 (solute carrier family 7 member 3), also called CAT-3, is a sodium-independent transporter selective for cationic amino acids, especially arginine. Highest mRNA levels are found in thymus, testis and placenta, with distinct expression in thalamus\/hippocampus of adult brain. By governing intracellular arginine, SLC7A3 modulates nitric-oxide synthesis and mTOR signalling, processes critical for immunity, neurotransmission and vascular tone.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25494 Product name: Recombinant human SLC7A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 433-506 aa of BC033816 Sequence: DQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQIVYVCSSLLAVLLTALCLVLAQWSVPLLSGD Predict reactive species\nFull Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 3\nCalculated Molecular Weight: 67 kDa\nObserved Molecular Weight: 62-70 kDa\nGenBank Accession Number: BC033816\nGene Symbol: SLC7A3\nGene ID (NCBI): 84889\nRRID: AB_3665521\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WY07\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869766799529,"sku":"27183-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27183-1-ap","provider":"Iright","version":"1.0","type":"link"}