{"product_id":"proteintech-27194-1-ap","title":"Proteintech, 27194-1-AP, CCDC8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC8 (27194-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC8 in WB, IP, IHC, ELISA applications with reactivity to human samples\n27194-1-AP targets CCDC8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCoiled-coil domain-containing protein 8 (CCDC8) is a 538-amino acid protein with the molecular mass of 59kD and 90kD cause of the posttranslational modifications including amidation, glycosylation, phosphorylation, and myristalation (PMID: 21737058). CCDC8 has 2 coiled-coil domains, and the proteins containing this domain are involved in diverse biological processes, such as the regulation of gene expression, cell division, and membrane fusion. CCDC8 is evolutionarily conserved, and CCDC8 mutation leads to the development of 3M syndrome in humans, a primordial growth disorder, by interacting with CUL7, OBSL1, and P53. Low-level or no expression of CCDC8 was shown to be closely related to the development of some tumors, such as renal cell carcinoma, multiple myeloma, breast cancer, and prostate cancer (PMID: 21737058, 27342910).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25794 Product name: Recombinant human CCDC8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-196 aa of BC025243 Sequence: EKSTPHPPQPPKKPKEPRVRRRVQQMVTPPPRLVVGTYDSSNASDSEFSDFETSRDKSRQGPRRGKKVRKMPVSYLGSKFLGSDLESEDDEELVEAFLRRQEKQPSAPPARRRVNLPVPMFEDNLGPQLSKADRWRE Predict reactive species\nFull Name: coiled-coil domain containing 8\nObserved Molecular Weight: 90 kDa, 59 kDa\nGenBank Accession Number: BC025243\nGene Symbol: CCDC8\nGene ID (NCBI): 83987\nRRID: AB_2880795\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0W5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869521793193,"sku":"27194-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27194-1-ap","provider":"Iright","version":"1.0","type":"link"}