{"product_id":"proteintech-27206-1-ap","title":"Proteintech, 27206-1-AP, Huntingtin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Huntingtin (27206-1-AP) by Proteintech is a Polyclonal antibody targeting Huntingtin in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n27206-1-AP targets Huntingtin in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human cerebellum tissue,  human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat cerebellum tissue, mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHTT(huntingtin), also named HD and IT15, belongs to the huntingtin family. HTT may play a role in microtubule-mediated transport or vesicle function. Defects in HTT are the cause of Huntington's disease (HD) which is an autosomal dominant neurodegenerative disorder characterized by involuntary movements (chorea), general motor impairment, psychiatric disorders, and dementia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25922 Product name: Recombinant human Huntingtin protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 2845-3000 aa of NM_002111 Sequence: LDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGE Predict reactive species\nFull Name: huntingtin\nCalculated Molecular Weight: 348 kDa\nGenBank Accession Number: NM_002111\nGene Symbol: Huntingtin\nGene ID (NCBI): 3064\nRRID: AB_2880799\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42858\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887673856169,"sku":"27206-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27206-1-ap","provider":"Iright","version":"1.0","type":"link"}