{"product_id":"proteintech-27214-1-ap","title":"Proteintech, 27214-1-AP, WNT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WNT2 (27214-1-AP) by Proteintech is a Polyclonal antibody targeting WNT2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n27214-1-AP targets WNT2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  MCF-7 cells\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWnt2 is a secreted glycoprotein that is one of the canonical Wnt ligands. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt2 is known to directly regulate β-catenin activity, the key player in proliferation and inflammation. Recently, studies have demonstrated that Wnt2 is overexpressed in various human cancers, including esophageal, gastric, colorectal, breast, lung, cervical, and malignant glioma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25845 Product name: Recombinant human WNT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-270 aa of BC029854 Sequence: GDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVY Predict reactive species\nFull Name: wingless-type MMTV integration site family member 2\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 34-40 kDa\nGenBank Accession Number: BC029854\nGene Symbol: WNT2\nGene ID (NCBI): 7472\nRRID: AB_2880804\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09544\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868909752489,"sku":"27214-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27214-1-ap","provider":"Iright","version":"1.0","type":"link"}