{"product_id":"proteintech-27218-1-ap","title":"Proteintech, 27218-1-AP, KIF2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF2A (27218-1-AP) by Proteintech is a Polyclonal antibody targeting KIF2A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n27218-1-AP targets KIF2A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKinesin Family Member 2A (KIF2A), also known as Kinesin-2, is a member of the kinesin-13 superfamily protein. KIF2A is a microtubule-depolymerizing kinesin motor protein with essential roles in neural progenitor division and axonal pruning during brain development. KIF2A is involved in microtubule depolymerization at minus ends of the spindle to generate pole-migration forces for chromosome movement. KIF2A is a crucial factor in the invasion and metastasis of various tumors, such as gastric cancer(PMID: 32801897), hepatocellular carcinoma(PMID: 36277155).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25692 Product name: Recombinant human KIF2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 528-679 aa of BC031828 Sequence: VDPTAAGDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL Predict reactive species\nFull Name: kinesin heavy chain member 2A\nCalculated Molecular Weight: 679 aa, 77 kDa\nObserved Molecular Weight: 80 kDa~100 kDa\nGenBank Accession Number: BC031828\nGene Symbol: KIF2A\nGene ID (NCBI): 3796\nRRID: AB_2880805\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00139\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869701165225,"sku":"27218-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27218-1-ap","provider":"Iright","version":"1.0","type":"link"}