{"product_id":"proteintech-27226-1-ap","title":"Proteintech, 27226-1-AP, FTO Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FTO (27226-1-AP) by Proteintech is a Polyclonal antibody targeting FTO in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human samples\n27226-1-AP targets FTO in WB, IHC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, MDA-MB-231 cells,  Caco-2 cells,  HEK-293 cells,  HeLa cells,  HEK-293T cells,  SH-SY5Y cells\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissue,  human colon tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human lymphoma tissue, human liver cancer tissue\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig, monkey, chicken, hamster, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species\nFull Name: fat mass and obesity associated\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: NM_001080432\nGene Symbol: FTO\nGene ID (NCBI): 79068\nRRID: AB_2880809\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C0B1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868823048361,"sku":"27226-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27226-1-ap","provider":"Iright","version":"1.0","type":"link"}