{"product_id":"proteintech-27231-1-ap","title":"Proteintech, 27231-1-AP, ALMS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALMS1 (27231-1-AP) by Proteintech is a Polyclonal antibody targeting ALMS1 in IF\/ICC, ELISA applications with reactivity to human samples\n27231-1-AP targets ALMS1 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALMS1 (Alstrom syndrome protein 1) is also KIAA0328. ALMS1 encodes a ~ 0.5 megadalton protein that localises to the base of centrioles. Some studies have suggested a role for this protein in maintaining centriole-nucleated sensory organelles termed primary cilia, and AS is now considered to belong to the growing class of human genetic disorders linked to ciliary dysfunction (ciliopathies). The ALMS1 protein is a component of the centrosome (PMID:30421101). ALMS1 is involved in PCM1-dependent intracellular transport. ALMS1 is required, directly or indirectly, for the localization of NCAPD2 to the proximal ends of centrioles. It is required for proper formation and\/or maintenance of primary cilia (PC), microtubule-based structures that protrude from the surface of epithelial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26100 Product name: Recombinant human ALMS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2881-3000 aa of NM_015120 Sequence: LEQRELFEQSKAPRADDHVRKHHSPSPQHQDYVAPDLPSCIFLEQRELFEQCKAPYVDHQMRENHSPLPQGQDSIASDLPSPISLEQCQSKAPGVDDQMNKHHFPLPQGQDCVVEKNNQH Predict reactive species\nFull Name: Alstrom syndrome 1\nCalculated Molecular Weight: 461 kDa\nGenBank Accession Number: NM_015120\nGene Symbol: ALMS1\nGene ID (NCBI): 7840\nRRID: AB_2880812\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TCU4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869634449577,"sku":"27231-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27231-1-ap","provider":"Iright","version":"1.0","type":"link"}