{"product_id":"proteintech-27237-1-ap","title":"Proteintech, 27237-1-AP, DACT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DACT1 (27237-1-AP) by Proteintech is a Polyclonal antibody targeting DACT1 in WB, ELISA applications with reactivity to human samples\n27237-1-AP targets DACT1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDACT1 (Dapper\/Frodo) is a member of the Dapper family, which includes three genes: DACT1, DACT2 and DACT3. As a tumor suppressor, DACT1 is downregulated in multiple tumor types, such as liver, colon and breast cancer . DACT1 is an important modulator of Wnt signaling, interacting with key components of the various Wnt transduction pathways. For instance, DACT1 binds to disheveled homolog 1 (Dvl1) to induce the degradation of Dvl1 and the subsequent inhibition of the Wnt\/β-catenin pathway . (PMID: 34252542, PMID: 29456669)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26096 Product name: Recombinant human DACT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 601-700 aa of NM_001079520 Sequence: VREKTRAGSKKCRFPDDLDTNKKLKKASSKGRKSGGGPEAGVPGRPAGGGHRAGSRAHGHGREAVVAKPKHKRTDYRRWKSSAEISYEEALRRARRGRRE Predict reactive species\nFull Name: dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis)\nCalculated Molecular Weight: 90 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: NM_001079520\nGene Symbol: DACT1\nGene ID (NCBI): 51339\nRRID: AB_3085940\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYF0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869529428137,"sku":"27237-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27237-1-ap","provider":"Iright","version":"1.0","type":"link"}