{"product_id":"proteintech-27252-1-ap","title":"Proteintech, 27252-1-AP, EPDR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPDR1 (27252-1-AP) by Proteintech is a Polyclonal antibody targeting EPDR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27252-1-AP targets EPDR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  Jurkat cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ependymin-related 1 (EPDR1) gene, also known as MERP1 and UCC1, encodes for a protein related to ependymins, which are type II transmembrane proteins that are similar to two families of cell adhesion molecules: the protocadherins and ependymins. Ependymin-related protein 1 (EPDR1) was recently identified as a secreted human batokine regulating mitochondrial respiration linked to thermogenesis in brown fat. Proteomics studies of mammalian mannose-6-phosphate (M6P) glycoproteins have identified EPDR1 as a lysosomal protein with unknown function. The lysosomal localization of EPDR1 was further demonstrated in mouse brain homogenates by subcellular fractionation.(PMID: 36343918, PMID: 33902536, PMID: 30729188)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26120 Product name: Recombinant human EPDR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-160 aa of BC018299 Sequence: QVMYQQSSGRNSRALLSYDGLNQRVRVLDERKALIPCKRLFEYILLYKDGVMFQIDQATKQCSKMTLTQPWDPLDIPQNSTFEDQYSIGGPQEQITVQEWSDRKSARSY Predict reactive species\nFull Name: Mammalian ependymin-related protein 1\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC018299\nGene Symbol: EPDR1\nGene ID (NCBI): 54749\nRRID: AB_3085942\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UM22\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869535064233,"sku":"27252-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27252-1-ap","provider":"Iright","version":"1.0","type":"link"}