{"product_id":"proteintech-27276-1-ap","title":"Proteintech, 27276-1-AP, KIF21A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF21A (27276-1-AP) by Proteintech is a Polyclonal antibody targeting KIF21A in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n27276-1-AP targets KIF21A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse brain tissue,  MCF-7\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF21A is well known for its association with congenital fibrosis of the extraocular muscles type 1 (CFEOM1). CFEOM1-related mutations in KIF21A relieve autoinhibition of the motor and third coiled-coil stalk, which results in enhanced accumulation of KIF21A in axonal growth cones and aberrant axon morphology in the oculomotor nerve.(PMID: 38767486)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26192 Product name: Recombinant human KIF21A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1125-1230 aa of NM_001173463 Sequence: MPLNSPGSEGSTLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAREKELSPPPGLPSKIGSISRQSSL Predict reactive species\nFull Name: kinesin family member 21A\nCalculated Molecular Weight: 187 kDa\nObserved Molecular Weight: 190-200 kDa\nGenBank Accession Number: NM_001173463\nGene Symbol: KIF21A\nGene ID (NCBI): 55605\nRRID: AB_2880825\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z4S6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869701001385,"sku":"27276-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27276-1-ap","provider":"Iright","version":"1.0","type":"link"}