{"product_id":"proteintech-27301-1-ap","title":"Proteintech, 27301-1-AP, SLC22A13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC22A13 (27301-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A13 in WB, ELISA applications with reactivity to mouse, rat samples\n27301-1-AP targets SLC22A13 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled mouse brain tissue, unboiled rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC22A13 (solute carrier family 22 member 13), also known as OCTL1. It is expected to be located in cell membrane and mainly expressed in kidney. The calculated molecular weight of SLC22A13 is 60 kDa. This antibody can recognize the 52 kDa isoform of target. This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24072 Product name: Recombinant human SLC22A13 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-273 aa of BC035973 Sequence: MAQFVQVLAEIGDFGRFQIQLLILLCVLNFLSPFYFFAHVFMILDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDRKHLKDTTQSVFMAGLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGLATAFVPSFELYMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVLAGLAYGFRNWRLLQITGTAPGLLLFFYFWALPE Predict reactive species\nFull Name: solute carrier family 22 (organic anion transporter), member 13\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 50-52, 60 kDa\nGenBank Accession Number: BC035973\nGene Symbol: SLC22A13\nGene ID (NCBI): 9390\nRRID: AB_3085944\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y226\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887804043433,"sku":"27301-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27301-1-ap","provider":"Iright","version":"1.0","type":"link"}