{"product_id":"proteintech-27339-1-ap","title":"Proteintech, 27339-1-AP, MRPL35 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPL35 (27339-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL35 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n27339-1-AP targets MRPL35 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse liver tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial ribosomal protein L35 (MRPL35) is a member of the large subunit family of mitochondrial ribosomal proteins. It plays a key role in the assembly of cytochrome C oxidase, involved in the translation of mitochondrial proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26300 Product name: Recombinant human MRPL35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-170 aa of BC020651 Sequence: TTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKRLREFVFCNKTQSKLLDKMTTSFWKRRN Predict reactive species\nFull Name: mitochondrial ribosomal protein L35\nCalculated Molecular Weight: 170 aa, 19 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC020651\nGene Symbol: MRPL35\nGene ID (NCBI): 51318\nRRID: AB_3669593\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZE8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887724548265,"sku":"27339-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27339-1-ap","provider":"Iright","version":"1.0","type":"link"}