{"product_id":"proteintech-27384-1-ap","title":"Proteintech, 27384-1-AP, DVL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DVL1 (27384-1-AP) by Proteintech is a Polyclonal antibody targeting DVL1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n27384-1-AP targets DVL1 in WB, IHC, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, NIH\/3T3 cells,  mouse cerebellum tissue,  HEK-293 cells,  MDA-MB-231 cells\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDVL1 is one of three DVL homologous proteins (DVL1-3) widely expressed in embryonic development and in the adult central nervous system. Dishevelled proteins are a necessary component of the Wnt and planar cell polarity developmental signaling pathways. Overexpression of DVL1 has been linked to prostate and breast cancers through the Wnt signaling pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26055 Product name: Recombinant human DVL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-416 aa of BC050454 Sequence: LGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELA Predict reactive species\nFull Name: dishevelled, dsh homolog 1 (Drosophila)\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 75 kDa, 73 kDa\nGenBank Accession Number: BC050454\nGene Symbol: DVL1\nGene ID (NCBI): 1855\nRRID: AB_2880859\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14640\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868881473705,"sku":"27384-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27384-1-ap","provider":"Iright","version":"1.0","type":"link"}