{"product_id":"proteintech-27403-1-ap","title":"Proteintech, 27403-1-AP, RAB5B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB5B (27403-1-AP) by Proteintech is a Polyclonal antibody targeting RAB5B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n27403-1-AP targets RAB5B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  HepG2 cells,  Jurkat cells,  NIH\/3T3 cells,  mouse lung tissue,  rat lung tissue\nPositive IHC detected in: human stomach tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB5B (Ras-related protein Rab-5B) belongs to the Rab family. Rab5 is specifically localized to the early compartment and regulates endocytosis (PMID:1516130, PMID:9087439). There are three isoforms of Rab5 namely, Rab5a, Rab5b, and Rab5c present in EE of mammalian cells (PMID:7789520). Recently, we have shown that Rab5a regulates fluid-phase endocytosis whereas receptor-mediated endocytosis is regulated by Rab5b in Leishmania (PMID:27226564).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26584 Product name: Recombinant human RAB5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-215 aa of BC032740 Sequence: GNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN Predict reactive species\nFull Name: RAB5B, member RAS oncogene family\nCalculated Molecular Weight: 215 aa, 24 kDa\nObserved Molecular Weight: 25-27 kDa\nGenBank Accession Number: BC032740\nGene Symbol: RAB5B\nGene ID (NCBI): 5869\nRRID: AB_2880862\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61020\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008154793,"sku":"27403-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27403-1-ap","provider":"Iright","version":"1.0","type":"link"}