{"product_id":"proteintech-27410-1-ap","title":"Proteintech, 27410-1-AP, CNTNAP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNTNAP3 (27410-1-AP) by Proteintech is a Polyclonal antibody targeting CNTNAP3 in WB, ELISA applications with reactivity to human samples\n27410-1-AP targets CNTNAP3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCNTNAP3 belongs to the Neurexin superfamily and is a member of the Contactin-Associated Protein (CNTNAP) family, which also includes well-studied members like CNTNAP2. CNTNAP3 is predominantly expressed in the central nervous system (CNS), including regions such as the cerebral cortex, hippocampus, and cerebellum. Its expression is primarily in neurons. Compared to its family member CNTNAP2, CNTNAP3 expression begins later in development and persists into adulthood, suggesting roles in both developmental processes and the maintenance of mature neural circuits.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26624 Product name: Recombinant human CNTNAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 625-695 aa of BC132737 Sequence: TDAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYAAGAGQLRSAVNLAERCEQRLALRCGTARRPDSRDGT Predict reactive species\nFull Name: contactin associated protein-like 3\nObserved Molecular Weight: 124 kDa\nGenBank Accession Number: BC132737\nGene Symbol: CNTNAP3\nGene ID (NCBI): 79937\nRRID: AB_2880864\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BZ76\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886709919913,"sku":"27410-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27410-1-ap","provider":"Iright","version":"1.0","type":"link"}