{"product_id":"proteintech-27420-1-ap","title":"Proteintech, 27420-1-AP, ELK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ELK1 (27420-1-AP) by Proteintech is a Polyclonal antibody targeting ELK1 in WB, ELISA applications with reactivity to human samples\n27420-1-AP targets ELK1 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  HeLa cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELK1 is a nuclear transcription factor of the ETS-domain family and the ternary complex factor (TCF) sub-family. It binds to purine-rich DNA sequences and forms a ternary complex with serum response factor (SRF) on the serum response element (SRE) located in the promoter regions of immediate early genes such as FOS and IER2. Upon activation of the JNK or MAPK\/ERK signaling cascades, ELK1 is phosphorylated and rapidly induces target-gene transcription, thereby regulating cell proliferation, differentiation, and survival.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26683 Product name: Recombinant human ELK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 161-320 aa of BC056150 Sequence: TFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLE Predict reactive species\nFull Name: ELK1, member of ETS oncogene family\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC056150\nGene Symbol: ELK1\nGene ID (NCBI): 2002\nRRID: AB_2880867\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19419\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940685481,"sku":"27420-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27420-1-ap","provider":"Iright","version":"1.0","type":"link"}