{"product_id":"proteintech-27430-1-ap","title":"Proteintech, 27430-1-AP, NODAL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NODAL (27430-1-AP) by Proteintech is a Polyclonal antibody targeting NODAL in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n27430-1-AP targets NODAL in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: human stomach cancer tissue, human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNodal is a member of the transforming growth factor-β (TGF-β) superfamily that plays critical roles during embryogenesis. Nodal also regulates cell proliferation, apoptosis, and invasion in cancer cells. However, it appears to exert both tumor-suppressing and tumor-promoting effects, depending on the cell type (PMID: 22645523). Nodal signals through ALK7 receptor to inhibit proliferation and to induce apoptosis in ovarian cancer cell lines and breast cancer cell lines (PMID: 15531507, PMID: 21383881).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26729 Product name: Recombinant human NODAL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-347 aa of BC104976 Sequence: EWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL Predict reactive species\nFull Name: nodal homolog (mouse)\nCalculated Molecular Weight: 347 aa, 40 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC104976\nGene Symbol: NODAL\nGene ID (NCBI): 4838\nRRID: AB_3085958\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96S42\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887739621545,"sku":"27430-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27430-1-ap","provider":"Iright","version":"1.0","type":"link"}