{"product_id":"proteintech-27437-1-ap","title":"Proteintech, 27437-1-AP, NKAP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NKAP (27437-1-AP) by Proteintech is a Polyclonal antibody targeting NKAP in WB, ELISA applications with reactivity to human samples\n27437-1-AP targets NKAP in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNKAP is a multifunctional nuclear protein that is involved in the activation of the ubiquitous transcription factor NF-kappaB. NKAP is associated with the the histone deacetylase HDAC3 and with the Notch corepressor complex, and it thereby acts as a transcriptional repressor of Notch target genes. It is also required for alphabeta T cell development. A related pseudogene has been identified on chromosome X, while a related and intronless retrocopy, which has an intact CDS and may be functional, is located on chromosome 6.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26637 Product name: Recombinant human NKAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC015354 Sequence: MAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKER Predict reactive species\nFull Name: NFKB activating protein\nCalculated Molecular Weight: 415 aa, 47 kDa\nObserved Molecular Weight: 47-50 kDa\nGenBank Accession Number: BC015354\nGene Symbol: NKAP\nGene ID (NCBI): 79576\nRRID: AB_3085959\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N5F7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887737393321,"sku":"27437-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27437-1-ap","provider":"Iright","version":"1.0","type":"link"}