{"product_id":"proteintech-27444-1-ap","title":"Proteintech, 27444-1-AP, SGK196 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SGK196 (27444-1-AP) by Proteintech is a Polyclonal antibody targeting SGK196 in WB, ELISA applications with reactivity to human, mouse, rat samples\n27444-1-AP targets SGK196 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, SH-SY5Y cells,  U-251 cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSGK196, also known as POMK (protein O-mannose kinase), is an enzyme that plays a significant role in multiple biological processes. As a type II transmembrane protein, SGK196 consists of a cytoplasmic tail, one transmembrane helix, and a luminal domain (PMID: 31913260). It is widely expressed in tissues such as skeletal muscle, brain, heart, and kidney. SGK196 has been identified as a valuable marker for melanoma and has been found to suppress the metastasis of basal-like breast cancer cells, suggesting its role in tumorigenesis and cell survival.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24922 Product name: Recombinant human SGK196 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-350 aa of BC101548 Sequence: VMCDSNDLPKTLSQYLLTSNFSILANDLDALPLVNHSSGMLVKCGHRELHGDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML Predict reactive species\nFull Name: protein kinase-like protein SgK196\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC101548\nGene Symbol: SGK196\nGene ID (NCBI): 84197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H5K3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887799586985,"sku":"27444-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27444-1-ap","provider":"Iright","version":"1.0","type":"link"}