{"product_id":"proteintech-27453-1-ap","title":"Proteintech, 27453-1-AP, CACNA2D1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nCACNA2D1 Polyclonal Antibody for WB, IHC, IF-P, ELISA\n27453-1-AP targets CACNA2D1 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse skeletal muscle tissue,  mouse cerebellum tissue,  rat brain tissue,  pig brain tissue\nPositive IHC detected in: human skeletal muscle tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26190 Product name: Recombinant human CACNA2D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-124 aa of NM_000722 Sequence: MEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVY Predict reactive species\nFull Name: calcium channel, voltage-dependent, alpha 2\/delta subunit 1\nCalculated Molecular Weight: 125 kDa\nObserved Molecular Weight: 125 kDa\nGenBank Accession Number: NM_000722\nGene Symbol: CACNA2D1\nGene ID (NCBI): 781\nRRID: AB_2880874\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54289\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932133033,"sku":"27453-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27453-1-ap","provider":"Iright","version":"1.0","type":"link"}