{"product_id":"proteintech-27470-1-ap","title":"Proteintech, 27470-1-AP, KIFC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIFC2 (27470-1-AP) by Proteintech is a Polyclonal antibody targeting KIFC2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n27470-1-AP targets KIFC2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKinesin family member C2 (KIFC2), one of the kinesin-14 motor family members, is especially expressed in neurons and is important for organizing dendritic microtubules and to control dendrite development (PMID: 37716704). KIFC2 is a microtubule-binding protein that functions as a motor protein in vesicle transport along axons and\/or dendrites. Western blot analysis detected KIFC2 at an apparent molecular mass of 96 kD(PMID: 9115737).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26519 Product name: Recombinant human KIFC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 132-254 aa of BC017311 Sequence: RSPRGRQALLQGTQPAPRVRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGATDSEKRVQHLTLENEALKQSLSLMR Predict reactive species\nFull Name: kinesin family member C2\nCalculated Molecular Weight: 90 kDa\nObserved Molecular Weight: 96 kDa\nGenBank Accession Number: BC017311\nGene Symbol: KIFC2\nGene ID (NCBI): 90990\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96AC6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887696367785,"sku":"27470-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27470-1-ap","provider":"Iright","version":"1.0","type":"link"}