{"product_id":"proteintech-27508-1-ap","title":"Proteintech, 27508-1-AP, IRS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRS2 (27508-1-AP) by Proteintech is a Polyclonal antibody targeting IRS2 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n27508-1-AP targets IRS2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRS2 (Insulin Receptor Substrate 2) is a widely expressed cytoplasmic adaptor protein and a member of the insulin receptor substrate (IRS) family. It plays a critical role in insulin and insulin-like growth factor-1 (IGF-1) signaling pathways. IRS2 is involved in a variety of biological processes, including metabolic regulation, cell growth, tumor metabolism, and immune responses. Through its N-terminal PH domain and PTB domain, IRS2 binds to activated insulin receptor (IR) or IGF-1 receptor (IGF-1R). Upon phosphorylation, it recruits and activates downstream signaling molecules such as PI3K, Grb2, and SHP2, thereby regulating cellular metabolism, proliferation, survival, and migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26427 Product name: Recombinant human IRS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 507-606 aa of NM_003749 Sequence: MPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRATFS Predict reactive species\nFull Name: IRS2\nCalculated Molecular Weight: 137 kDa\nObserved Molecular Weight: 160-190 kDa\nGenBank Accession Number: NM_003749\nGene Symbol: IRS2\nGene ID (NCBI): 8660\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y4H2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887686701225,"sku":"27508-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27508-1-ap","provider":"Iright","version":"1.0","type":"link"}