{"product_id":"proteintech-27534-1-ap","title":"Proteintech, 27534-1-AP, TMEM45A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM45A (27534-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM45A in WB, ELISA applications with reactivity to human samples\n27534-1-AP targets TMEM45A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A-253 cells, A431 cells,  MDA-MB-231 cells,  SKOV-3 cells,  HH cells,  HFF cells,  HaCaT cells,  MJ cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM45A, also known as DERP7, DNAPTP4, or FLJ10134, is a transmembrane protein belonging to the TMEM family. TMEM45A is highly expressed in keratinocytes and its expression correlates with keratinization, suggesting a role in normal epidermal physiology(PMID: 22954140; PMID: 24689342). TMEM45A promotes cell proliferation, migration, and invasion in glioblastoma cells, favors epithelial-mesenchymal transition (EMT) in colorectal cancer and promotes cell proliferation by favoring the G1\/S cell cycle transition in ovarian cancer cells (PMID: 37936608). The predicted molecular weight of TMEM45A is 32 kDa, and 66-98 kDa has been reported in the literature(PMID: 22954140).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24392 Product name: Recombinant human TMEM45A protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 229-275 aa of BC040355 Sequence: YAVTIVIVGMNYAFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM Predict reactive species\nFull Name: transmembrane protein 45A\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC040355\nGene Symbol: TMEM45A\nGene ID (NCBI): 55076\nRRID: AB_3669609\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NWC5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887832846505,"sku":"27534-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27534-1-ap","provider":"Iright","version":"1.0","type":"link"}