{"product_id":"proteintech-27569-1-ap","title":"Proteintech, 27569-1-AP, C1GALT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C1GALT1 (27569-1-AP) by Proteintech is a Polyclonal antibody targeting C1GALT1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n27569-1-AP targets C1GALT1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MKN-45 cells, HepG2 cells,  T-47D cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1), also known as B3Gal-T8, catalyzes the transfer of galactose (Gal) from UDP-Gal to N-acetylgalactosamine (GalNAc) O-linked esters of threonine and serine residues of target proteins, including IgA1, to form the T antigen (PMID: 28209808). C1GalT1 is overexpressed in many common cancers includingcolon, breast, gastric, lung, head and neck, pancreatic, esophageal, prostate, and hepatocellular cancer (PMID: 34944925). C1GALT1 protein contains 363 amino acids and is a typeII transmembrane protein. Rate C1GalT1 is an 84\/86KDa disulfide-bonded homodimer, but its active form is believed to be a 42\/43 KDa monomeric protein (PMID: 34149900).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26144 Product name: Recombinant human C1GALT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 263-363 aa of NM_020156 Sequence: MKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP Predict reactive species\nFull Name: core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 42-45 kDa\nGenBank Accession Number: NM_020156\nGene Symbol: C1GALT1\nGene ID (NCBI): 56913\nRRID: AB_2880912\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NS00\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869519663273,"sku":"27569-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27569-1-ap","provider":"Iright","version":"1.0","type":"link"}