{"product_id":"proteintech-27578-1-ap","title":"Proteintech, 27578-1-AP, UST Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UST (27578-1-AP) by Proteintech is a Polyclonal antibody targeting UST in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n27578-1-AP targets UST in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, SW480 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUST (Uronyl 2-sulfotransferase) is an enzyme that catalyzes the transfer of sulfate groups to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (PMID: 10187838). UST is a critical regulator of melanoma cell adhesion and motility in vitro and in vivo. Abnormal expression or activity of UST has also been associated with certain diseases, such as breast pericanalicular fibroadenoma and acute retinal necrosis (PMID: 25480151).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25483 Product name: Recombinant human UST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-406 aa of BC093668 Sequence: PRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGDQPVYINIIRDPVNRFLSNYFFRRFGDWRGEQNHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPGEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPHYFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHYVKEQFHLLKRKFGLKSHVSKPPLRPHFFIPTPLETEEPIDDEEQDDEKWLEDIYKR Predict reactive species\nFull Name: uronyl-2-sulfotransferase\nCalculated Molecular Weight: 406 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC093668\nGene Symbol: UST\nGene ID (NCBI): 10090\nRRID: AB_3669611\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2C2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887919091881,"sku":"27578-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27578-1-ap","provider":"Iright","version":"1.0","type":"link"}