{"product_id":"proteintech-27583-1-ap","title":"Proteintech, 27583-1-AP, TRANK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRANK1 (27583-1-AP) by Proteintech is a Polyclonal antibody targeting TRANK1 in WB, ELISA applications with reactivity to Human samples\n27583-1-AP targets TRANK1 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEtratricopeptide repeat and ankyrin repeat containing 1 (TRANK1), has been confirmed as the susceptibility gene for BD (bipolar disorder). An integrated analysis of mRNA co-expression networks revealed that genes highly correlated with TRANK1 were significantly involved in the biological processes related to synaptic plasticity, dendritic spine, axon guidance and circadian rhythm. In addition, TRANK1 rs71947856 variant was associated with circadian regulation and Kleine-Levin syndrome, which is a rare disease characterized by severe episodic hypersomnia, with cognitive impairment and apathy or disinhibition.(PMID: 34014031)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26206 Product name: Recombinant human TRANK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 901-1000 aa of NM_014831 Sequence: MVLDHCKLADSIKAICNAYNRGLSCVLRKKLKGINKGQVSANMKIQKRIPRCYVEDTEAEKGREHVNPEYFPPASAVETEYNIMKFHSFSTNMAFNILNDT Predict reactive species\nFull Name: lupus brain antigen 1\nCalculated Molecular Weight: 336 kDa\nObserved Molecular Weight: ~330 kDa\nGenBank Accession Number: NM_014831\nGene Symbol: LBA1\nGene ID (NCBI): 9881\nRRID: AB_3669612\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15050\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887836909737,"sku":"27583-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27583-1-ap","provider":"Iright","version":"1.0","type":"link"}