{"product_id":"proteintech-27587-1-ap","title":"Proteintech, 27587-1-AP, RYR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RYR2 (27587-1-AP) by Proteintech is a Polyclonal antibody targeting RYR2 in IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples\n27587-1-AP targets RYR2 in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\nPositive FC (Intra) detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRYR2 belongs to the ryanodine receptor family. RYR2 provides communication between transverse-tubules and sarcoplasmic reticulum. Contraction of cardiac muscle is triggered by release of calcium ions from SR following depolarization of T-tubules. Defects in RYR2 are the cause of familial arrhythmogenic right ventricular dysplasia type 2 (ARVD2) which known as arrhythmogenic right ventricular cardiomyopathy 2 (ARVC2). Defects in RYR2 are the cause of catecholaminergic polymorphic ventricular tachycardia type 1 (CPVT1) which known as stress-induced polymorphic ventricular tachycardia (VTSIP).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26296 Product name: Recombinant human RYR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1311-1410 aa of NM_001035 Sequence: MAEVFSKTVAGGLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVL Predict reactive species\nFull Name: ryanodine receptor 2 (cardiac)\nCalculated Molecular Weight: 565 kDa\nGenBank Accession Number: NM_001035\nGene Symbol: RYR2\nGene ID (NCBI): 6262\nRRID: AB_2880916\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92736\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887791231145,"sku":"27587-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27587-1-ap","provider":"Iright","version":"1.0","type":"link"}