{"product_id":"proteintech-27602-1-ap","title":"Proteintech, 27602-1-AP, ASPN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASPN (27602-1-AP) by Proteintech is a Polyclonal antibody targeting ASPN in WB, IHC, ELISA applications with reactivity to human samples\n27602-1-AP targets ASPN in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, SW480 cells,  HeLa cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nASPN, also known as periodontal ligament-associated protein1 (PLAP1), is an extracellular matrix (ECM) protein. The calculated molecular weight of ASPN is 43 kDa. It belongs to the small leucine-rich proteoglycans (SLRPs) family and contains a unique aspartate-rich N terminus that distinguishes it from other SLRPs family members. It was firstly identified in human cartilage and it was associated with the pathogenesis of bone and joint diseases, including osteoarthritis, intervertebral disc degeneration and periodontal ligament mineralization (PMID:11152692; 26089687).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26380 Product name: Recombinant human ASPN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-330 aa of BC063114 Sequence: DDEEDNSLFPTREPRSHFFPFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKENDFKGLTSLYGLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNKLKKIPSGLPELKYLQIIFLHSNSIAR Predict reactive species\nFull Name: asporin\nCalculated Molecular Weight: 384 aa, 44 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC063114\nGene Symbol: ASPN\nGene ID (NCBI): 54829\nRRID: AB_3085974\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXN1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885074567337,"sku":"27602-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27602-1-ap","provider":"Iright","version":"1.0","type":"link"}