{"product_id":"proteintech-27623-1-ap","title":"Proteintech, 27623-1-AP, DBNDD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DBNDD2 (27623-1-AP) by Proteintech is a Polyclonal antibody targeting DBNDD2 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n27623-1-AP targets DBNDD2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26356 Product name: Recombinant human DBNDD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-161 aa of BC001105 Sequence: DTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS Predict reactive species\nFull Name: dysbindin (dystrobrevin binding protein 1) domain containing 2\nCalculated Molecular Weight: 261 aa, 28 kDa\nObserved Molecular Weight: 28-29 kDa\nGenBank Accession Number: BC001105\nGene Symbol: DBNDD2\nGene ID (NCBI): 55861\nRRID: AB_2880927\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BQY9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869529624745,"sku":"27623-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27623-1-ap","provider":"Iright","version":"1.0","type":"link"}