{"product_id":"proteintech-27633-1-ap","title":"Proteintech, 27633-1-AP, CHAF1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHAF1B (27633-1-AP) by Proteintech is a Polyclonal antibody targeting CHAF1B in WB, IHC, ELISA applications with reactivity to human samples\n27633-1-AP targets CHAF1B in WB, IHC, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HeLa cells,  HepG2 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHAF1B, also named as CAF1A, CAF1P60, MPHOSPH7, MPP7, is a 559 amino acid protein, which belongs to the WD repeat HIR1 family. CHAF1B as a subunit of the CAF-1 complex that contains RBBP4, CHAF1B and CHAF1A. CHAF1B is thought to mediate chromatin assembly in DNA replication and DNA repair and assembles histone octamers onto replicating DNA in vitro. The calcualted molecular weight of CHAF1B is 61 kDa, but molecular weight of CHAF1B is detected about 65-70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26504 Product name: Recombinant human CHAF1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-559 aa of BC021218 Sequence: TFEKDELGIPLKEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTPASRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP Predict reactive species\nFull Name: chromatin assembly factor 1, subunit B (p60)\nCalculated Molecular Weight: 559 aa, 61 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC021218\nGene Symbol: CHAF1B\nGene ID (NCBI): 8208\nRRID: AB_2880933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13112\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869524349097,"sku":"27633-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27633-1-ap","provider":"Iright","version":"1.0","type":"link"}