{"product_id":"proteintech-27636-1-ap","title":"Proteintech, 27636-1-AP, SLC38A6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC38A6 (27636-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A6 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n27636-1-AP targets SLC38A6 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC38A6 is also known as SNAT6 and belongs to the amino acid\/polyamine transporter 2 family. SLC38A6 is probably a sodium-dependent amino acid\/proton antiporter or a neuronal transporter for glutamate. SLC38A6 has 2 isoforms with the molecular mass of 51 kDa and 58 kDa. The observed molecular weight of SLC38A6 is 43 kDa, which is consistent with the description in the literature of MW between 37 kDa and 50 kDa (PMID: 24752331).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24654 Product name: Recombinant human SLC38A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-250 aa of BC110378 Sequence: IIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVIIKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESA Predict reactive species\nFull Name: solute carrier family 38, member 6\nCalculated Molecular Weight: 456 aa, 51 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC110378\nGene Symbol: SLC38A6\nGene ID (NCBI): 145389\nRRID: AB_3085978\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IZM9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806533801,"sku":"27636-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27636-1-ap","provider":"Iright","version":"1.0","type":"link"}