{"product_id":"proteintech-27650-1-ap","title":"Proteintech, 27650-1-AP, HIF3A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HIF3A (27650-1-AP) by Proteintech is a Polyclonal antibody targeting HIF3A in WB, IF\/ICC, ELISA applications with reactivity to human samples\n27650-1-AP targets HIF3A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Cobalt Chloride treated HeLa cells, A431 cells\nPositive IF\/ICC detected in: Tunicamycin treated HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHIF3A, Hypoxia-inducible factor 3-alpha, acts as a transcriptional regulator in adaptive response to low oxygen tension (PMID:11573933, PMID:16126907, PMID:19694616, PMID:20416395, PMID:21069422). It functions as an inhibitor of angiogenesis in hypoxic cells of the cornea. HIF3A also plays a role in the development of the cardiorespiratory system. HIF3A was up-regulated by hypoxia (PMID:16775626). Multiple alternatively spliced transcript variants have been found.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26574 Product name: Recombinant human HIF3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 401-486 aa of NM_022462 Sequence: MALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD Predict reactive species\nFull Name: hypoxia inducible factor 3, alpha subunit\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: NM_022462\nGene Symbol: HIF3A\nGene ID (NCBI): 64344\nRRID: AB_2880939\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2N7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955529385,"sku":"27650-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27650-1-ap","provider":"Iright","version":"1.0","type":"link"}