{"product_id":"proteintech-27682-1-ap","title":"Proteintech, 27682-1-AP, EGR4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EGR4 (27682-1-AP) by Proteintech is a Polyclonal antibody targeting EGR4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n27682-1-AP targets EGR4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  MDA-MB-231 cells,  PC-12 cells,  SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEGR4 is a member of the Early Growth Response (EGR) family of transcription factors, which also includes EGR1, EGR2, and EGR3. These proteins are characterized by their rapid and transient induction in response to a wide array of extracellular signals. EGR4 functions as a sequence-specific DNA-binding protein that regulates the expression of target genes involved in critical biological processes, most notably in the nervous and immune systems.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26687 Product name: Recombinant human EGR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-140 aa of NM_001965 Sequence: MPGSALERRGAAARGRCGRARAPRLPDSFPRGECPKPGARAPRSVRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKSTEGCCAEPSAELPRLPARDA Predict reactive species\nFull Name: early growth response 4\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 62-70 kDa\nGenBank Accession Number: NM_001965\nGene Symbol: EGR4\nGene ID (NCBI): 1961\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q05215\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887460274345,"sku":"27682-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27682-1-ap","provider":"Iright","version":"1.0","type":"link"}