{"product_id":"proteintech-27691-1-ap","title":"Proteintech, 27691-1-AP, AVPR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AVPR2 (27691-1-AP) by Proteintech is a Polyclonal antibody targeting AVPR2 in WB, ELISA applications with reactivity to human samples\n27691-1-AP targets AVPR2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 769-P cells, 786-O cells,  Caki-1 cells,  Caki-2 cells,  OS-RC-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAVPR2 is a Gs-coupled vasopressin receptor essential for renal water reabsorption, acting through cAMP-PKA-dependent trafficking of aquaporin-2. Localized to principal cells of the collecting duct, AVPR2 integrates hormonal cues to maintain osmotic and fluid homeostasis. Mutations lead to X-linked nephrogenic diabetes insipidus, while rare activating variants cause SIADH. Because of its central role in renal physiology and clear clinical associations, AVPR2 is a key target in water-balance disorders and pharmacologic modulation of diuresis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24835 Product name: Recombinant human AVPR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-83 aa of BC112181 Sequence: MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCL Predict reactive species\nFull Name: arginine vasopressin receptor 2\nCalculated Molecular Weight: 371 aa, 40 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC112181\nGene Symbol: AVPR2\nGene ID (NCBI): 554\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30518\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885159501993,"sku":"27691-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27691-1-ap","provider":"Iright","version":"1.0","type":"link"}