{"product_id":"proteintech-27707-1-ap","title":"Proteintech, 27707-1-AP, FTSJD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FTSJD2 (27707-1-AP) by Proteintech is a Polyclonal antibody targeting FTSJD2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n27707-1-AP targets FTSJD2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-251 cells, NIH\/3T3 cells\nPositive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCap1 2′-O-methylation is catalyzed by cap methyltransferase 1 (CMTR1). CMTR1, also called IFN-stimulated gene 95 kDa protein (ISG95) or FTSJD2, is elevated by a viral infection and required to promote IFN-mediated induction of ISGs and the antiviral response. High CMTR1 expression is associated with poor prognosis in patients with CRC (PMID: 37024465). CMTr1 binds ATP-dependent RNA DHX15 helicase and that this interaction, mediated by the G-patch domain of CMTr1, has an advantageous effect on CMTr1 activity towards highly structured RNA substrates (PMID: 30397098).). Human CMTR1 is a 95 kDa nuclear protein that has multiple domains, consisting of a G-patch domain, a RrmJ\/FtsJ methyltransferase domain, a non-functional cap guanylyltransferase-like domain and a WW domain (PMID: 30312682).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26722 Product name: Recombinant human FTSJD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 499-835 aa of BC031890 Sequence: SNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQKFLIGLGKSQIYTWDGRQSDRWIKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSIAPFHICYYGRLFWEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA Predict reactive species\nFull Name: FtsJ methyltransferase domain containing 2\nCalculated Molecular Weight: 835 aa, 95 kDa\nObserved Molecular Weight: 96-100 kDa\nGenBank Accession Number: BC031890\nGene Symbol: FTSJD2\nGene ID (NCBI): 23070\nRRID: AB_2880949\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N1G2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644299433,"sku":"27707-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27707-1-ap","provider":"Iright","version":"1.0","type":"link"}