{"product_id":"proteintech-27720-1-ap","title":"Proteintech, 27720-1-AP, SLC25A42 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A42 (27720-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A42 in WB, ELISA applications with reactivity to human, mouse samples\n27720-1-AP targets SLC25A42 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse adipose tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A42 is a member of the SLC25 family of mitochondrial solute carriers. It is involved in the transport of crucial metabolic intermediates across the inner mitochondrial membrane, facilitating energy production and cellular metabolism. The gene encoding SLC25A42 is located on the human chromosome and expresses a protein that acts as a transporter in the mitochondria, aiding in the efficient exchange of molecules between the cytoplasm and the mitochondrial matrix. This protein has a calculated molecular weight of 30-35 kDa.This transporter may play a role in various physiological processes, potentially influencing mitochondrial function and overall cellular health (PMID: 40246810).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26313 Product name: Recombinant human SLC25A42 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC045598 Sequence: MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRV Predict reactive species\nFull Name: solute carrier family 25, member 42\nCalculated Molecular Weight: 318 aa, 35 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC045598\nGene Symbol: SLC25A42\nGene ID (NCBI): 284439\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86VD7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887805059241,"sku":"27720-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27720-1-ap","provider":"Iright","version":"1.0","type":"link"}