{"product_id":"proteintech-27722-1-ap","title":"Proteintech, 27722-1-AP, ABCG5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABCG5 (27722-1-AP) by Proteintech is a Polyclonal antibody targeting ABCG5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n27722-1-AP targets ABCG5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HepG2 cells,  mouse colon tissue,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26844 Product name: Recombinant human ABCG5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of NM_022436 Sequence: MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSCRQQWTRQILKDVSLYVESGQIMCIL Predict reactive species\nFull Name: ATP-binding cassette, sub-family G (WHITE), member 5\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 68 kDa~72 kDa\nGenBank Accession Number: NM_022436\nGene Symbol: ABCG5\nGene ID (NCBI): 64240\nRRID: AB_2880952\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H222\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868847886505,"sku":"27722-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27722-1-ap","provider":"Iright","version":"1.0","type":"link"}