{"product_id":"proteintech-27740-1-ap","title":"Proteintech, 27740-1-AP, Histone H2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Histone H2B (27740-1-AP) by Proteintech is a Polyclonal antibody targeting Histone H2B in WB, IF\/ICC, ChIP, ELISA applications with reactivity to human samples\n27740-1-AP targets Histone H2B in WB, IF\/ICC, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HEK-293T cells,  HEK-293 cells\nPositive IF\/ICC detected in: HEK-293 cells\nPositive ChIP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\nChromatin immunoprecipitation (ChIP): CHIP : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. HIST3H2BB is a replication-dependent histone that is a member of the histone H2B family.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26901 Product name: Recombinant human HIST3H2BB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC100855 Sequence: MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Predict reactive species\nFull Name: histone cluster 3, H2bb\nObserved Molecular Weight: 15-20 kDa\nGenBank Accession Number: BC100855\nGene Symbol: Histone H2B\nGene ID (NCBI): 128312\nRRID: AB_3085992\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N257\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869693300905,"sku":"27740-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27740-1-ap","provider":"Iright","version":"1.0","type":"link"}