{"product_id":"proteintech-27747-1-ap","title":"Proteintech, 27747-1-AP, SLC24A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC24A5 (27747-1-AP) by Proteintech is a Polyclonal antibody targeting SLC24A5 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n27747-1-AP targets SLC24A5 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue, A375 cells,  rat eye tissue\nPositive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24254 Product name: Recombinant human SLC24A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 412-500 aa of BC113628 Sequence: LCLGIPWFIKTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLATLSVLYELGIIGNNKIRGCGG Predict reactive species\nFull Name: solute carrier family 24, member 5\nCalculated Molecular Weight: 500 aa, 55 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC113628\nGene Symbol: SLC24A5\nGene ID (NCBI): 283652\nRRID: AB_2880959\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q71RS6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869602205865,"sku":"27747-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27747-1-ap","provider":"Iright","version":"1.0","type":"link"}