{"product_id":"proteintech-27754-1-ap","title":"Proteintech, 27754-1-AP, DDIAS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDIAS (27754-1-AP) by Proteintech is a Polyclonal antibody targeting DDIAS in WB, ELISA applications with reactivity to human samples\n27754-1-AP targets DDIAS in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, K-562 cells,  NCI-H1299 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNA damage-induced apoptosis suppressor (DDIAS) is an oncogenic protein that is highly expressed in several cancers, including colorectal, lung, breast, and hepatocellular carcinoma (HCC), and stimulates cancer cell proliferation and cell cycle progression.DDIAS protects cancer cells from DNA damage reagents and tumor necrosis factor-associated apoptosis-inducing ligands (TRAILs) and positively regulates cancer cell invasion by stabilizing the β- catenin positively regulates cancer cell invasion. Therefore, DDIAS is considered as a potential therapeutic target for malignant lung cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26829 Product name: Recombinant human C11orf82 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-170 aa of BC039268 Sequence: IYPSCQKCFSRIILVSKRSNCPKCGSTGESGNANYRYKLSLKVAESNKLFVITVFGSCLDTFFGLTATGLHRYIQDPNKIPETLDNDTTQNLLTKAVETCFVGQSFIFGVTNFENQPGQGSDASNFLQQCSDHKRKAKALVACQIVLPDP Predict reactive species\nFull Name: chromosome 11 open reading frame 82\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC039268\nGene Symbol: C11orf82\nGene ID (NCBI): 220042\nRRID: AB_3669620\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IXT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887106609321,"sku":"27754-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27754-1-ap","provider":"Iright","version":"1.0","type":"link"}