{"product_id":"proteintech-27763-1-ap","title":"Proteintech, 27763-1-AP, RRAD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RRAD (27763-1-AP) by Proteintech is a Polyclonal antibody targeting RRAD in WB, ELISA applications with reactivity to human, mouse, rat samples\n27763-1-AP targets RRAD in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, SKOV-3 cells,  rat heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRRAD is also named as RAD1. RRAD, a member of the Ras-like small GTPase family, was initially identified as a gene associated with Type II diabetes since it was found to be overexpressed in some Type II diabetic patients (PMID: 8248782). RRAD overexpression reduced insulin-stimulated glucose uptake in cultured muscle and adipocytes cells (PMID: 8798502). RRAD was found to be frequently down-regulated in different types of human cancers, including lung cancer, breast cancer, and nasopharyngeal carcinoma, etc, due to the hypermethylation of its promoter (PMID: 17195088).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26869 Product name: Recombinant human RRAD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-141 aa of BC057815 Sequence: SMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLM Predict reactive species\nFull Name: Ras-related associated with diabetes\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 29-34 kDa\nGenBank Accession Number: BC057815\nGene Symbol: RRAD\nGene ID (NCBI): 6236\nRRID: AB_3085993\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55042\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887789232297,"sku":"27763-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27763-1-ap","provider":"Iright","version":"1.0","type":"link"}